PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr5g010470.1
Common NameMTR_5g010470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 830aa    MW: 94573.9 Da    PI: 7.5724
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr5g010470.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.94.8e-13753148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W   Ede+l+ av ++G+++W++I++ +   +++kqck rw+ +l
  Medtr5g010470.1  7 KGVWKNTEDEILKAAVMKYGKNQWARISSLLV-CKSAKQCKARWYEWL 53
                     789*****************************.99**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.233157IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.4E-18656IPR009057Homeodomain-like
SMARTSM007171.2E-13655IPR001005SANT/Myb domain
PfamPF139211.8E-111070No hitNo description
CDDcd001674.53E-111053No hitNo description
SuperFamilySSF466891.26E-1633104IPR009057Homeodomain-like
CDDcd116592.69E-2455104No hitNo description
Gene3DG3DSA:1.10.10.601.3E-857102IPR009057Homeodomain-like
PROSITE profilePS5129411.18458105IPR017930Myb domain
SMARTSM007170.002358103IPR001005SANT/Myb domain
PfamPF118313.3E-48413627IPR021786Pre-mRNA splicing factor component Cdc5p/Cef1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MSIMTKKGVW KNTEDEILKA AVMKYGKNQW ARISSLLVCK SAKQCKARWY EWLDPSIKKT  60
EWTREEDEKL LHLAKVMPTQ RRTISVGRTP SQCLERYEKL LDAACVKDGN YEPGDDPRKL  120
RPGGIDPNPE SKPPRPDPVD MDEDEKEMLS EACARLANTK GKKAKRKARE KQLEEAGRLA  180
SLQKKRELKA AGIDIRQRRR KRRGIDYNAE IPFEKRPPPG YFDVADEDRE VEQRFPTTIE  240
ELEGKRRIDV EAQLRKQDVA RNKIAERQDA PAAILHARKL NDPETVRKRS KLMLPPPQIS  300
DQELDEIAKF GYASDLVGSD ELTKGSSATR ALLPNYPQTP NQAMTPLRTP QRTPAGKGDA  360
IMMEAENLAR LRESQTLLLG GENPELHPSD FSGVTPKKKE IHIPSPLLTP SATPGSAGLT  420
PRSGMTPARD GFSFGMTPKG TPLRDELHIN EDMEMRDSAK LELRRQADMK KSLRSGLSSL  480
PQPKNEYQIV MQPIQEDAEE PEEKIEEDMS DRMAREKAEE EARQQALLRK RSKVLQRELP  540
TPPPASLELI RNSLIRADGD KSSFVPPTPI EQADEMIRKE LQALLEHDNA KYPLEEIEDE  600
MKSADQLMKD ETQYLCEAMG HGNDSLEDFV EAHTTCINDL MYFDTPLQNE FENMRSKLYD  660
GKEKMTRLEK KVTLLTQGYE WSWGLFKAAN MGELSQLFSA FVSLTPQVKK RSDCIFSNSV  720
VETPVFVEHI KADSWKWLPP RVRGGRGLYN SGYKHKNLHK NVAEDEHSNL QKTKTLKVIL  780
NIIRPKYPNE LHGKWVFILP SFSLLLFGVD VGDELFWIHL IRFDCTMSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3jb9_W1e-8832222236Pre-mRNA-splicing factor cdc5
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183202KKRELKAAGIDIRQRRRKRR
2196202QRRRKRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.222990.0leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP1022170.0FP102217.2 Medicago truncatula chromosome 5 clone mtrs-65h5, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611111.10.0pre-mRNA splicing factor component protein
SwissprotP929480.0CDC5L_ARATH; Cell division cycle 5-like protein
TrEMBLG7KDD40.0G7KDD4_MEDTR; Pre-mRNA splicing factor component protein
STRINGGLYMA10G30870.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40723354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09770.10.0cell division cycle 5
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]